General Information

  • ID:  hor004531
  • Uniprot ID:  O00230
  • Protein name:  Cortistatin-17
  • Gene name:  CORT
  • Organism:  Homo sapiens (Human)
  • Family:  Somatostatin family
  • Source:  Human
  • Expression:  Expressed in a subset of GABAergic cells in the cortex and hippocampus.
  • Disease:  Diseases associated with CORT include Prolactinoma and Neuroblastoma.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007193 adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway; GO:0007268 chemical synaptic transmission; GO:0030334 regulation of cell migration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0045202 synapse

Sequence Information

  • Sequence:  DRMPCRNFFWKTFSSCK
  • Length:  17
  • Propeptide:  MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
  • Signal peptide:  MPLSPGLLLLLLSGATAT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  It also inhibits cAMP production induced by forskolin through SSTRs.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GHSR
  • Target Unid:  Q92847
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  5-16
  • Structure ID:  AF-O00230-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004531_AF2.pdbhor004531_ESM.pdb

Physical Information

Mass: 243907 Formula: C96H141N27O24S3
Absent amino acids: AEGHILQVY Common amino acids: F
pI: 9.76 Basic residues: 4
Polar residues: 6 Hydrophobic residues: 4
Hydrophobicity: -78.24 Boman Index: -4949
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: 6257.06 Extinction Coefficient cystines: 5625
Absorbance 280nm: 351.56

Literature

  • PubMed ID:  NA
  • Title:  NA